Protein Info for HP15_3253 in Marinobacter adhaerens HP15

Annotation: ferritin-like DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00210: Ferritin" amino acids 18 to 156 (139 residues), 87.6 bits, see alignment E=4e-29

Best Hits

Swiss-Prot: 52% identical to Y1349_HAEIN: Uncharacterized protein HI_1349 (HI_1349) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 91% identity to maq:Maqu_3485)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQW0 at UniProt or InterPro

Protein Sequence (157 amino acids)

>HP15_3253 ferritin-like DNA-binding protein (Marinobacter adhaerens HP15)
MGKNFIGLDTEKTAKLADSLNDLLSNYQIFYMNVRGYHWNIKGDNFFELHVKFEELYDDL
LLKIDEIAERVLTLGHRPAHAYSTYIERSEVPERKDVSDGKEAMDNIVESFAKLIGKQRT
LLSLAGEADDEGTVALMSDYISQQEKTVWMYRSYLGH