Protein Info for Psest_3370 in Pseudomonas stutzeri RCH2

Annotation: prepilin-type N-terminal cleavage/methylation domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 27 (27 residues), 35.4 bits, see alignment 5.2e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 31.9 bits, see alignment 4e-12 PF12019: GspH" amino acids 43 to 153 (111 residues), 65.2 bits, see alignment E=7.2e-22

Best Hits

KEGG orthology group: K08084, type IV fimbrial biogenesis protein FimT (inferred from 51% identity to pfv:Psefu_3822)

Predicted SEED Role

"Type IV fimbrial biogenesis protein FimT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR47 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Psest_3370 prepilin-type N-terminal cleavage/methylation domain (Pseudomonas stutzeri RCH2)
MRHFRGFTLIELIVTLAVLAILLAIAAPSFQSTIQSNRTQTITNDLTSALQLARSEAVKR
GAKVDICRRNGEVCANAADWGNGWLVQVKGGAVLRVWDAVGGQDTVTGPNETLTYRPNGL
LTKVNDAAHTTFTVAFANCSGKTQYTVTLTATGRVTSTKGTCP