Protein Info for PGA1_c33540 in Phaeobacter inhibens DSM 17395

Annotation: A/G-specific adenine glycosylase MutY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR01084: A/G-specific adenine glycosylase" amino acids 14 to 277 (264 residues), 294.2 bits, see alignment E=5.5e-92 PF00730: HhH-GPD" amino acids 49 to 165 (117 residues), 62.3 bits, see alignment E=1.1e-20 PF00633: HHH" amino acids 113 to 138 (26 residues), 33.6 bits, see alignment (E = 4.7e-12) PF10576: EndIII_4Fe-2S" amino acids 203 to 219 (17 residues), 20.7 bits, see alignment (E = 8.1e-08) PF14815: NUDIX_4" amino acids 246 to 352 (107 residues), 63.6 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 76% identity to sit:TM1040_2645)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERL0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PGA1_c33540 A/G-specific adenine glycosylase MutY (Phaeobacter inhibens DSM 17395)
MRDLNSQSQPQSSILLEWYDQHARSLPWRISPADRAAGVWPDPYRIWLSEVMLQQTTVAA
VKDYFHRFTSRWPTVADLAAAPDADVMAEWAGLGYYARARNLLKCARVVAQDYGGIFPNT
YDGLIALPGIGPYTAAAISAIAFNRQETVLDGNVERVMARLYDVHVPLPTAKPQLKEKAA
ALTPAERPGDHAQAVMDLGATICTPRNPACGICPWRTPCAARAAGTATELPKKTPKKPKP
TRLGIVYLARSAAGDWLLEQRPDKGLLGGMLGWPGSDWTDSPDSPAPAPPFEADWQLLNA
EVRHTFTHFHLILRVMLAELPADFAAEENQRVIARHDFKPTDLPTVMRKAFDLWKGR