Protein Info for Psest_3364 in Pseudomonas stutzeri RCH2

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 17 to 19 (3 residues), see Phobius details transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 317 to 339 (23 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 392 to 409 (18 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details PF01554: MatE" amino acids 23 to 183 (161 residues), 87 bits, see alignment E=6e-29 amino acids 248 to 406 (159 residues), 53 bits, see alignment E=1.7e-18 TIGR00797: MATE efflux family protein" amino acids 23 to 416 (394 residues), 255.9 bits, see alignment E=3e-80

Best Hits

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 94% identity to psa:PST_0980)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRA8 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Psest_3364 putative efflux protein, MATE family (Pseudomonas stutzeri RCH2)
MSSMLAAWRDAPTHSKVWALAAPMILSNLSVPLVALVDSSVIGHLPHAHQLGAVAVGGSL
YTLLVWVMGFLRMGTTGFAAQAAGRNDGGALRQILLQGLLLALGFALLLGAIGVPLKGAA
LQLMQPSAELDELTRDYFHTRLFGLPAALASYALIGWFLGTQNARAPLAILLTTNLINVV
LDLWFVLGLDWGVAGAARASVIAEWSGALLGLALTRKALARYPGRLDTRALRRWLSWRPL
MAVNRDIFLRSLALQLVFLLVTVQGTRLGDATVAANALLLNGLLLTAHALDGLAHAVEAL
AGHAIGARNRDALQRVMVVAGGWSLLASVAFGLFFLLGGQLFIQLQTDIPEVRQTALTYL
PYLAALPLIAVWSYLLDGLFIGATRAREMRNSMLLAVGLTLPLGWLLQGLGNHGLWLAFL
SFMLMRGVCLGVLAQRLQRRGAWFTMGAPSTTHSEGH