Protein Info for PGA1_c00330 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Error-prone polymerase for DNA repair (imuB or polY like)
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Related to imuB from Caulobacter. Also similar to PA0670, which is induced by the SOS response, even though it does not seem to have mutant phenotypes related to DNA repair.
Original annotation: protein imuB-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF00817: IMS" amino acids 1 to 94 (94 residues), 23.8 bits, see alignment E=3.6e-09 PF11799: IMS_C" amino acids 181 to 280 (100 residues), 28.6 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: K14161, protein ImuB (inferred from 68% identity to sil:SPO0671)

Predicted SEED Role

"DNA polymerase-like protein PA0670" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DL07 at UniProt or InterPro

Protein Sequence (433 amino acids)

>PGA1_c00330 Error-prone polymerase for DNA repair (imuB or polY like) (Phaeobacter inhibens DSM 17395)
MAHSDARAFCPDLQTAAADIYRDQQFLLILRRWATRYCPWVGLEGRDGLVLDISGSSHLF
GGETGMLNAIRNGLMRVGLSAQIGLADTRGAAWALAHYGEGQAATGDMLPALQHLPVAAL
RLDEKTTTALIRLGLRKIGDLATTPRAPLARRFGANVLMRLDQALGHQAEEITPLTAPPH
YGVRMTLPEPIGLISDVMAGTERLLTQLCAKLKTHEMGARIFVITLRRVDLDQQEVELRL
ARALRDPQRILPLFEKELAEIDAGFGIDQLRLEATQTEALPTQQMSHVAGDGDDRLEDLI
TRIGTRIGLENIQRFLPADSHIPERSFIVAPAAYSATASGWTCKTPRPLCLFPPEPIPGS
GPYPPNHFRWRRVSLTTGHTIGPERITPEWWLEDDNWRSGMRDYWRVETTQGRRLWLFYT
PQNPGWFVQGEFA