Protein Info for PGA1_c33460 in Phaeobacter inhibens DSM 17395

Annotation: oxidoreductase UcpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00106: adh_short" amino acids 6 to 193 (188 residues), 192.1 bits, see alignment E=1.1e-60 PF08659: KR" amino acids 7 to 183 (177 residues), 47.8 bits, see alignment E=2.5e-16 PF13561: adh_short_C2" amino acids 12 to 235 (224 residues), 148.6 bits, see alignment E=3.5e-47

Best Hits

KEGG orthology group: None (inferred from 69% identity to sit:TM1040_2637)

MetaCyc: 32% identical to BadH (Rhodopseudomonas palustris)
R267-RXN

Predicted SEED Role

"FIG062860: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)" in subsystem Lipopolysaccharide-related cluster in Alphaproteobacteria

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3J4 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PGA1_c33460 oxidoreductase UcpA (Phaeobacter inhibens DSM 17395)
MEIKGKTVVITGASRGIGADAARVFAAAGANLALLARSEESLSALAKEIGGNVLTFTCDV
ADYPAVAAAIAKTEAQFGRIDVLINNAGVVDPIARLEAADPADWAQLIDINVNGVFNGMR
AVLPGMKAAGGGTVLTVSSGAAHNPVEGWSAYCSSKAAAAMLTRSLHHEEGANGIRAMGL
SPGTVATEMQRVIKASGVNPVSQLEWSDHIPAEWPARALLWMCTEAADDLVGTEISLRDE
GIRRQVGLI