Protein Info for Psest_3356 in Pseudomonas stutzeri RCH2

Annotation: D-fructose-responsive transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 327 (326 residues), 418.2 bits, see alignment E=1.2e-129 PF00356: LacI" amino acids 3 to 47 (45 residues), 49.6 bits, see alignment 5.6e-17 PF00532: Peripla_BP_1" amino acids 62 to 246 (185 residues), 79.6 bits, see alignment E=5.6e-26 PF13407: Peripla_BP_4" amino acids 65 to 261 (197 residues), 60.5 bits, see alignment E=3.9e-20 PF13377: Peripla_BP_3" amino acids 181 to 327 (147 residues), 37.3 bits, see alignment E=6.2e-13

Best Hits

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 91% identity to psa:PST_0987)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPB1 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_3356 D-fructose-responsive transcription factor (Pseudomonas stutzeri RCH2)
MKLTDIARLANVSVTTASYVLNGKAAQRRISPATVERVMAVAEQQGFQLDQQAAGLRRGQ
SRTLGFIVPDLENPSYARLAKLLEQRARQRGYQLLIAGTDDEPDTERQLIQLLRSRRCDA
LIVASCLPGDDQSYRKVQAAGTPVIALDRALDAEQFCSVVSDDLEAAALLTRSLAVPARA
HIALISARPALPISQQREEGFRQALSQHTGQVSILRAEQFSRTCGREQMLALLDRGPLPD
ALITTAYVLLEGVFDALRERDLLWPEHLRLATFGDAQLLDFLPIRVNAISQQHEQIAERT
LEQAIRAIEQSDYRPGVIAIERELKVRRP