Protein Info for Psest_3354 in Pseudomonas stutzeri RCH2

Updated annotation (from data): 1-phosphofructokinase (EC 2.7.1.56)
Rationale: Specifically important for utilizing D-Fructose. Automated validation from mutant phenotype: the predicted function (1PFRUCTPHOSN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: 1-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03828: 1-phosphofructokinase
  • amino acids 4 to 307 (304 residues), 351.8 bits, E=2.8e-109
• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 4 to 307 (304 residues), 348.7 bits, E=2.2e-108
• PF00294: PfkB
  • amino acids 11 to 291 (281 residues), 182.6 bits, E=6e-58

Best Hits

Swiss-Prot: 45% identical to K1PF_XANCP: 1-phosphofructokinase (fruK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 83% identity to psa:PST_0989)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

• fructose degradation (1/1 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• galactitol degradation (2/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• lactose degradation I (1/5 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.56

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

See L0GR98 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Psest_3354 1-phosphofructokinase (EC 2.7.1.56) (Pseudomonas stutzeri RCH2)
MARVLTVTLNPALDLTVQLPALRLGEVNRSDSLQVHAAGKGLNVAQVLADLGHQLTVTGF
LGEGNPQAFEQLFSARGFTDEFVRVAGETRSNLKLAEADGRVTDINGPGLAVSEAQRAEL
LARLKRLVPAHELVVVAGSLPRGIDSQWFVQLLNSLKALGVRVALDTSGAALRDGLATRP
WLIKPNEEELAEARGIELSGSSALAAEAQRLQEEGIEHVVVSQGADGVSWFSPGAALHAS
PPKVRVVSTVGAGDSLLAGMLHGLLEGWPAERTLTHATAIAAQAVGQVGFGITDTAQLAE
LQAAVRLQPLSQ