Protein Info for Psest_3349 in Pseudomonas stutzeri RCH2

Annotation: Sel1 repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF08238: Sel1" amino acids 40 to 74 (35 residues), 32.8 bits, see alignment 3.7e-12 amino acids 75 to 109 (35 residues), 31.7 bits, see alignment 8.5e-12 amino acids 114 to 146 (33 residues), 32.9 bits, see alignment 3.5e-12 amino acids 147 to 182 (36 residues), 24.3 bits, see alignment 1.8e-09

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 61% identity to avn:Avin_12410)

Predicted SEED Role

"FOG: TPR repeat, SEL1 subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR92 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psest_3349 Sel1 repeat. (Pseudomonas stutzeri RCH2)
MPHLLRREETLDTEQLGHLAEQPQRAARLVLAAAAAGELEAQALLGQILLDGRGIEADPA
LALTWFSIAADHGHAMACNMAGRCHEHGWGMPANPVRAADFYRRAAEMGLDWGMYNLANL
LATGRGIPQDEAAAYRLYRQAAELGHAKSMNLTGRCLEDGCGVTRDVSAAHAWYQCSAEA
GDFRGQFSHAAVLLAQQQWDAARHWLSRALELGHLKFIETALASLQAAALPQIADIVVAY
ARRRDELR