Protein Info for Psest_3348 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized iron-regulated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF13640: 2OG-FeII_Oxy_3" amino acids 84 to 176 (93 residues), 57.1 bits, see alignment E=3.1e-19 PF18331: PKHD_C" amino acids 183 to 225 (43 residues), 79.1 bits, see alignment 2e-26

Best Hits

Swiss-Prot: 96% identical to Y995_PSEU5: PKHD-type hydroxylase PST_0995 (PST_0995) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 96% identity to psa:PST_0995)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM55 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Psest_3348 Uncharacterized iron-regulated protein (Pseudomonas stutzeri RCH2)
MLLRIANVFSREETGRIRTALEQADWQDGRVTAGYQSAKAKHNLQLAEDDALAREIAEAM
LQRLWQHPQFMSAALPSKVFPPLFNCYTAGGEFGYHIDNAVRQVRNSAERVRTDLSATLF
FSDPDEYDGGELVIHDTYGTQQVKFAAGDMVLYPSTSLHKVEPVTRGARLASFFWIQSLV
REDAQRTLLYEMDQAIQQLTADVPEHPSLVQLTGTYHNLLRRWVEV