Protein Info for HP15_3226 in Marinobacter adhaerens HP15

Annotation: fis-like DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF27465: Fis_N" amino acids 1 to 54 (54 residues), 54.3 bits, see alignment E=1.4e-18 PF02954: HTH_8" amino acids 62 to 102 (41 residues), 52.6 bits, see alignment E=3.1e-18

Best Hits

Swiss-Prot: 59% identical to FIS_PECCP: DNA-binding protein Fis (fis) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 91% identity to maq:Maqu_3449)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQC5 at UniProt or InterPro

Protein Sequence (105 amino acids)

>HP15_3226 fis-like DNA-binding protein (Marinobacter adhaerens HP15)
MSAETLANDNLSTPANDDIHQLQTVNNSGNTVTLRDSVEVALKNYFAQLDGAPVTEVYQL
VLSEVEAPLLEQVMKYTRNNQTKASTMLGLNRGTLRKKLKQYGLL