Protein Info for HP15_3221 in Marinobacter adhaerens HP15
Annotation: acetyl-CoA biotin carboxyl carrier
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to BCCP_ECO57: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Escherichia coli O157:H7
KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 85% identity to maq:Maqu_3444)MetaCyc: 66% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII
MetaCyc Pathways
- biotin-carboxyl carrier protein assembly (4/4 steps found)
- 3-hydroxypropanoate cycle (5/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
- glyoxylate assimilation (4/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PQC0 at UniProt or InterPro
Protein Sequence (155 amino acids)
>HP15_3221 acetyl-CoA biotin carboxyl carrier (Marinobacter adhaerens HP15) MDIRKIKKLIELLEESDVEELEIHEADDSVRISRRREPAAGTQYVSHYPAPAPAQQPAPA PAASAPASEESSAPAAPAGHSVKSPMVGTFYRSPSPTAKAFVEVGQTVNVGDVICIVEAM KMMNQIEADKSGTIQDILVENGQPVEFDQPLVVIS