Protein Info for Psest_3341 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane receptor for ferrienterochelin and colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07715: Plug" amino acids 45 to 157 (113 residues), 101.1 bits, see alignment E=7.7e-33 PF00593: TonB_dep_Rec_b-barrel" amino acids 281 to 694 (414 residues), 177.5 bits, see alignment E=1.4e-55 PF14905: OMP_b-brl_3" amino acids 442 to 654 (213 residues), 29.9 bits, see alignment E=4.5e-11

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 82% identity to pmk:MDS_0910)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP93 at UniProt or InterPro

Protein Sequence (743 amino acids)

>Psest_3341 Outer membrane receptor for ferrienterochelin and colicins (Pseudomonas stutzeri RCH2)
MSIPFSRTALSCAMIGCSWTALAQNAPVTLNDTVVSASGFEQKITEAPASISVISREDLQ
QKRYSNLAQALDDVEGIDIRQGTGKTGGLNISIRGMPSDYTLILIDGRRQNTAGNVTPNG
FNETSTSFMPPMSAIERIEVIRGPMSTLYGSDAMGGVVNIITKKVANEWGGSVSLDHTFQ
ENRDYGDTSNTSLYASGPLIDNLLGLAVRGSLYDRAESDLSFDNDSPVSKRGASPVEGRN
HVLGARLTLTPDEAHDISLDFERGRQVYNNDDCQLGNLDGKNGGSANDGCTADAPTKANG
YADELRFERDQFALSHTGRFSFGTLDSSLTHNTTETIGRTIPGTPIGNSYTGYPSIVIGD
DRELKSTDLILDTKLVSPVGESHILTVGGQYWDAKVTDGIADDDFQQKSWAMFVEDEWRL
RHDLALTLGARYEDHEAFGGHISPRAYLVWNTNDNWTMKGGVSRGYKTPTLNQLHDGISG
VTSQGAVITVGSPDLDPEVTTNTEFGVYFDNLSGFSANATVFHNKFDDKIDDGTPIANCF
SATNPNQPGCVSFGSGFTQDSFAQSVNIDEAVTQGLELAGRWEFAPAWALAMNYTYTDSE
QKSGANKGAPLTNTPEHMLHARISWQTTDRLNLWFKGEYRGERTRFTDRYENLTAANQAL
YDAAGDLKAYEVFHLGGSFKASESVTLNATIYNLFDKDFTEGTYYTTNTGTSGWASDYIQ
SAAATSGTLEEGRRLWLSANFTF