Protein Info for HP15_3219 in Marinobacter adhaerens HP15

Annotation: two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 PF00072: Response_reg" amino acids 131 to 237 (107 residues), 33.8 bits, see alignment E=3.3e-12 amino acids 251 to 362 (112 residues), 85.1 bits, see alignment E=3.9e-28 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 376 to 535 (160 residues), 155.6 bits, see alignment E=5e-50 PF00990: GGDEF" amino acids 378 to 530 (153 residues), 147.4 bits, see alignment E=3.3e-47

Best Hits

KEGG orthology group: None (inferred from 85% identity to maq:Maqu_3442)

Predicted SEED Role

"Probable two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQB8 at UniProt or InterPro

Protein Sequence (537 amino acids)

>HP15_3219 two-component response regulator (Marinobacter adhaerens HP15)
MNDESQKEKLRQHFARRVTTQARVVLDTWQKIHEDRDKASAHRNEFAAATDKLVRYAQRF
EMDSHARAGQTTLALINQWEPGSALNESLERQLQDAIETLSQSTLRRTDLNSSEAPHQFR
RTPVYIALANQEMAARLIRQLEFFGFRASAFANADELTEACALHKPETILVDVNFGGSPN
AGITTIERLQERHDTPIPIIFMSDEDGSIETRLQASRCGGEEFFYPAVDPGQLIEKIETY
THGNTVEPYKVLVLDDSRAQAKYMETVLKKAGMTAHIITDPMQIIHALEEFSPEIIILDM
YMPGCTGMEIARVIRQQDRFHSVPIIYLSAEEDVTKQLHAMSLGGDDFLTKPIDPKHLIA
TIHNRGRRARSLLALMIRDSLTGLFNHTHTLHLLDQEIVRARQKEQPLCFAMIDIDYFKK
VNDTFGHPIGDRVLRSLSMFLKQRLRKTDHIGRYGGEEFAIILPNTRPSDARNVLNEIRE
RFSELQQPAGDREFNVTFSCGIAAWDDNTSQALCERADRALYSSKELGRNCVTLADS