Protein Info for Psest_3339 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 107 to 140 (34 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details PF02518: HATPase_c" amino acids 313 to 412 (100 residues), 66.9 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 99% identity to psa:PST_1003)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR84 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Psest_3339 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MYASVPLLSASRQNLRLLTLIRIVVLAAQSGAVGVAYATQLLTLPWLALGITLAVSAVLC
LGTALRLRGPWPVTELEYAVHLGCDLLVHSALLYYSGGSTNPFVSYYLVPLTIAAATLPW
LYSIVLSGLALLGYTLMLVWYDPLTLPPFERATLQVYGMWLSFALAAALITFFVARMAEQ
LRRQEQQQAQRREESMRDQQLLAVATQAAGAAHELGTPLATMSVLLKELRQEYNDEQLNE
DLGLLQSQVQLCKESLRQLVRAAEADRRQAVVEQTAREWVESVLQRWHLMRPEATYRFHC
VGLGSAPKLMPPADLSQSLLNLLNNATDASPEDLEIRLDWDAQWIRLTIRDHGAGVPLAI
AEQIGRPFITTKGKGFGLGLFLSQASVTRAGGTVKLYNHEEGGTLTELRLPHGSVRA