Protein Info for PGA1_c33220 in Phaeobacter inhibens DSM 17395
Annotation: hemimethylated DNA-binding protein, YccV-like
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to HSPQ_WIGBR: Heat shock protein HspQ (hspQ) from Wigglesworthia glossinidia brevipalpis
KEGG orthology group: K11940, heat shock protein HspQ (inferred from 88% identity to sit:TM1040_0063)Predicted SEED Role
"FIG00987702: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7F143 at UniProt or InterPro
Protein Sequence (108 amino acids)
>PGA1_c33220 hemimethylated DNA-binding protein, YccV-like (Phaeobacter inhibens DSM 17395) MLRTRAKYNLGQVVRHRKHPFRGVVFDVDPEFANTEEWYEAIPEDSRPVKDQPYYHLLAE NDQTYYVAYVSEQNLIADYSGEPVGHPDIPEMFGSFDDGSYALHYQLN