Protein Info for PGA1_c33220 in Phaeobacter inhibens DSM 17395

Annotation: hemimethylated DNA-binding protein, YccV-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF08755: YccV-like" amino acids 6 to 99 (94 residues), 104.2 bits, see alignment E=2.1e-34 TIGR02097: hemimethylated DNA binding domain" amino acids 6 to 103 (98 residues), 127.1 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 32% identical to HSPQ_WIGBR: Heat shock protein HspQ (hspQ) from Wigglesworthia glossinidia brevipalpis

KEGG orthology group: K11940, heat shock protein HspQ (inferred from 88% identity to sit:TM1040_0063)

Predicted SEED Role

"FIG00987702: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F143 at UniProt or InterPro

Protein Sequence (108 amino acids)

>PGA1_c33220 hemimethylated DNA-binding protein, YccV-like (Phaeobacter inhibens DSM 17395)
MLRTRAKYNLGQVVRHRKHPFRGVVFDVDPEFANTEEWYEAIPEDSRPVKDQPYYHLLAE
NDQTYYVAYVSEQNLIADYSGEPVGHPDIPEMFGSFDDGSYALHYQLN