Protein Info for HP15_3208 in Marinobacter adhaerens HP15

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 38 (15 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 335 to 365 (31 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 22 to 213 (192 residues), 49.7 bits, see alignment E=5.7e-17 PF02687: FtsX" amino acids 296 to 415 (120 residues), 41.3 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 74% identity to maq:Maqu_3432)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQA7 at UniProt or InterPro

Protein Sequence (424 amino acids)

>HP15_3208 ABC-type antimicrobial peptide transport system, permease component (Marinobacter adhaerens HP15)
MKARLALTLALASLWHRKRVLALVCLTLTLSVSLLLGIQYLRTEVKQSFTSTINGTDLII
GARSGQLNLLLYTVFHIGDATNNIRWSTYQGLKQDNRLAWLIPISLGDSYRGNRVVATDE
NFFKHFRYGRDLPLELDEGQWFEGVFDVVLGAGVARSLAHQVGEQIVLSHGGGRTSFSNH
EDTPFTVTGILAPTGTPVDQAVYISLDGMEAMHVGWESGVAIPGRTITPEQAKGRDFTPD
AITAVFVGIDRQILTFRIQREINQFAGEPLSAILPGVALSELWRLMGQFERALLGITGFV
VVTSLIGLIAVLLTLQAQRAHEIAVLRATGASPALIASLYILECVALALAACVMALALGM
AGLALSSPWLLANYGLQIELRPLTPEEWTLMALVPVAAFTVALIPAFNTWRQSRRLGFGE
AADQ