Protein Info for Psest_3327 in Pseudomonas stutzeri RCH2

Annotation: cell shape determining protein, MreB/Mrl family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 9 to 337 (329 residues), 530.7 bits, see alignment E=6.8e-164 PF06723: MreB_Mbl" amino acids 11 to 337 (327 residues), 489.8 bits, see alignment E=7.5e-151 PF00022: Actin" amino acids 15 to 202 (188 residues), 35.7 bits, see alignment E=1e-12 PF00012: HSP70" amino acids 106 to 285 (180 residues), 48 bits, see alignment E=1.5e-16 PF14450: FtsA" amino acids 160 to 318 (159 residues), 43.9 bits, see alignment E=7.5e-15

Best Hits

Swiss-Prot: 79% identical to MREB_SALTI: Cell shape-determining protein MreB (mreB) from Salmonella typhi

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 100% identity to psa:PST_1015)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM35 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Psest_3327 cell shape determining protein, MreB/Mrl family (Pseudomonas stutzeri RCH2)
MFKKLRGMFSSDLSIDLGTANTLIYVRDRGIVLDEPSVVAIRSHGNQKSVVAVGTEAKRM
LGRTPGNINAIRPMKDGVIADFSVCEKMLQYFINKVHENSFLQPSPRVLICVPCKSTQVE
RRAIRESALGAGAREVFLIEEPMAAAIGAGLPVDEARGSMVVDIGGGTTEIALISLNGVV
YAESVRVGGDRFDESIVTYVRRNYGSLIGESTAERIKQEIGTAFPGGELREVDVRGRNLA
EGVPRSFTLNSNEVLEALQESLATIVQAVKSALEQSPPELASDIAERGLVLTGGGALLRD
LDKLLAQETGLPVIVAEEPLTCVARGGGRALEMMDRHAMDLLSTE