Protein Info for HP15_3197 in Marinobacter adhaerens HP15
Annotation: twin-arginine translocation subgoup
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to TATB_MARHV: Sec-independent protein translocase protein TatB (tatB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 70% identity to maq:Maqu_3421)Predicted SEED Role
"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PQ96 at UniProt or InterPro
Protein Sequence (157 amino acids)
>HP15_3197 twin-arginine translocation subgoup (Marinobacter adhaerens HP15) MFDIGFLELLICGVIALLVLGPERLPAAARAAGRWVGGARRMVGQFTSELDRELKAGELR DELRKAGDVGLDDVQKTVRGALDEARKYEHMILPENETQKPRPAPATRRVSGQPKASEAP AQDQPDAGSSSQTPDSGSDGNEQPKRETPQSPPDNRS