Protein Info for HP15_3196 in Marinobacter adhaerens HP15
Annotation: twin-arginine translocation protein TatA/E
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to TATA_MARHV: Sec-independent protein translocase protein TatA (tatA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
KEGG orthology group: K03116, sec-independent protein translocase protein TatA (inferred from 76% identity to maq:Maqu_3420)Predicted SEED Role
"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PQ95 at UniProt or InterPro
Protein Sequence (79 amino acids)
>HP15_3196 twin-arginine translocation protein TatA/E (Marinobacter adhaerens HP15) MGISIWQLLIVLGIVILLFGTKKLRNIGSDLGGAIRGFKKSMSDEDSKAENQESLEGKEG EQPQQQAAAEDKPRDKSHS