Protein Info for Psest_3305 in Pseudomonas stutzeri RCH2

Annotation: ABC-type transport system involved in resistance to organic solvents, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR04430: outer membrane lipid asymmetry maintenance protein MlaD" amino acids 4 to 146 (143 residues), 178.8 bits, see alignment E=2.7e-57 PF02470: MlaD" amino acids 38 to 115 (78 residues), 78.9 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 51% identical to MLAD_ECO57: Intermembrane phospholipid transport system binding protein MlaD (mlaD) from Escherichia coli O157:H7

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 98% identity to psa:PST_1039)

Predicted SEED Role

"Uncharacterized ABC transporter, periplasmic component YrbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP50 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psest_3305 ABC-type transport system involved in resistance to organic solvents, periplasmic component (Pseudomonas stutzeri RCH2)
MRIRTLEMGVGLFLLAGLLALLLLSLRVSGLSVGSADTYKLYAYFDNIAGLTVRSKVTMA
GVTIGKVTAIDLDRDSYTGRVTLEIQQDVNILPADSTASILTAGLLGEKYVGISVGGDDE
LLKDGDTIQDTQSSLVLEDLIGKFLLNSVNRD