Protein Info for PGA1_c32920 in Phaeobacter inhibens DSM 17395

Annotation: dihydrodipicolinate reductase DapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF01113: DapB_N" amino acids 11 to 132 (122 residues), 110.4 bits, see alignment E=9.3e-36 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 11 to 272 (262 residues), 267.5 bits, see alignment E=6.8e-84 PF01118: Semialdhyde_dh" amino acids 11 to 104 (94 residues), 26.2 bits, see alignment E=1.4e-09 PF05173: DapB_C" amino acids 135 to 271 (137 residues), 147.9 bits, see alignment E=2.1e-47

Best Hits

Swiss-Prot: 82% identical to DAPB_RUEST: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 82% identity to sit:TM1040_0087)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3F1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PGA1_c32920 dihydrodipicolinate reductase DapB (Phaeobacter inhibens DSM 17395)
MAASRTDIPGIVITGASGRMGQMLIKTIADHPRAHLVGAVEREGHDWVGQDVGLAMGGSE
IGITVTDDAPAAFAKAQAVIDFTSPEATIAFAGMAAEAGVVHVIGTTGMNDAQIVQLEPA
SRHSVQMRAGNMSLGVNLLVQLTKKVAAALDEDFDIEVIEAHHHHKVDAPSGTALMLGEA
AAEGRGVTLSDVSDSGRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAGQGERIVLRHLA
TDRAIFARGAIKAALWGQGKEPGQYDMLDVLGL