Protein Info for PGA1_c32880 in Phaeobacter inhibens DSM 17395

Annotation: putative ribosomal RNA small subunit methyltransferase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF01029: NusB" amino acids 6 to 124 (119 residues), 60.1 bits, see alignment E=4.6e-20 PF01189: Methyltr_RsmB-F" amino acids 222 to 417 (196 residues), 147.8 bits, see alignment E=5e-47 PF13649: Methyltransf_25" amino acids 233 to 297 (65 residues), 29.2 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 74% identity to sit:TM1040_0089)

Predicted SEED Role

"16S rRNA m(5)C 967 methyltransferase (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DV22 at UniProt or InterPro

Protein Sequence (421 amino acids)

>PGA1_c32880 putative ribosomal RNA small subunit methyltransferase B (Phaeobacter inhibens DSM 17395)
MSNATQARRRAIHLLDEVLGEGKLLSECYAAGALDKLPAEERARTQRLATDTLRNLERAD
RILQKHLKKATPLTVHNALRIGTVELCQGGAAHGVVNEMVDIVSRHRRHGKLKGLVNAVL
RKVADHGPAEWAKLRVPRLPKWLRSPLSQAWGAPAMLQIEAAHLAGAPLDLSPKPGADLS
ALEAVLLPTGSYRIHNSVQVSGLPGFATGDWWVQDAAAALPAQILAAKPGESVLDLCAAP
GGKTMQIAAAGANVTAVDQSAGRMARLSENLERTGLEATVVVGDALEQTGQYDAVLLDSP
CSATGTIRRHPDLPHAKDGSGFGALIELQAQMLAHAWSLVKPGGRLIYCTCSLLPDEGEC
QVEDALEMFPDMSVGDRIRDIAGIDPDWITEEGGLRLRPDYWADLGGMDGFYMAELRKST
V