Protein Info for Psest_3297 in Pseudomonas stutzeri RCH2

Updated annotation (from data): histidinol-phosphate aminotransferase (EC 2.6.1.9)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01141.
Original annotation: histidinol-phosphate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR01141: histidinol-phosphate transaminase" amino acids 8 to 347 (340 residues), 310.4 bits, see alignment E=6.8e-97 PF00155: Aminotran_1_2" amino acids 25 to 347 (323 residues), 212.6 bits, see alignment E=5e-67

Best Hits

Swiss-Prot: 84% identical to HIS81_PSEAE: Histidinol-phosphate aminotransferase 1 (hisC1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 92% identity to psa:PST_1047)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM05 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Psest_3297 histidinol-phosphate aminotransferase (EC 2.6.1.9) (Pseudomonas stutzeri RCH2)
MSKFWSPFVKDLVPYVPGEQPKLSKLVKLNTNENPYGPSPRAIAAMQAELNDSLRLYPDP
NGERLKQAVADYYGVQPAQVFVGNGSDEVLAHAFHGLFQHAGPLLFPDISYSFYPVYCGL
YGIAYETVALDEQFQIDVADYNRPNGGIIFPNPNAPTGCLLALEAIERLLQANTETVVLV
DEAYVDFGGESAIALVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALERIKNSFN
SYPLDRIAIAGAAAAFEDRAYFQQTCQQVIDSREAVVAAMQGLGFEVLPSAANFIFARHP
QRDAATIAASLREQGVIVRHFKQRRIEQFLRITIGTPEQNQALLEALG