Protein Info for PGA1_c32870 in Phaeobacter inhibens DSM 17395

Annotation: putative heparinase II/III-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 PF07940: Hepar_II_III_C" amino acids 299 to 557 (259 residues), 242.6 bits, see alignment E=2.1e-76

Best Hits

KEGG orthology group: None (inferred from 76% identity to sit:TM1040_0090)

Predicted SEED Role

"Heparinase II/III-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3E7 at UniProt or InterPro

Protein Sequence (580 amino acids)

>PGA1_c32870 putative heparinase II/III-like protein (Phaeobacter inhibens DSM 17395)
MSRYDRMARRGTRLLNRYYARRSRRQPGATAFVSQPEPRTIGSFARGRQLVAGNLLFAGY
LVESPTTALWDVVAPDLAFDAERHGFAWLDDLAAVGDFRAREKAQLWVWGWIDTHGNGSG
PGWSPDLTGRRVIRWINHALFLLAARTADQSEAFFGALSRQTWFLSRRWQGASPGLPRFE
ALTGLIYAGLALKGHEDQVDPALKALAEECASQIDEQGGLPTRNPEELLEVFTLLTWAAA
ALQDAGRGVPPAQLAAIERIAPTLRTLRHADGGLARFHGGGRGLEGRLDHALAASHVTTR
HADGLAMGYARLSGRRTSVIIDASVPPKGRASWNGHASTLAFELTSGRRPLIVNCGSGET
FGVEWRRAGRATPSHSTLCIEGHSSARLAPPERGSGHEIMTEAPDNVPLDLSDLEDGYRF
QGGHNGYERHFGLTHARTLELAVDGRGLAGEDMLLALDTRNKRRFDKAMDAHSLGGIGFE
IRLHLHPDVDAALDLGGAAVSMALKSGEIWVFRHDGTCELKLEPSVYLEKTRLKPRAAKQ
IVLSGRAMNYATRIRWTLSKAQETAVAVRDLNRDDPELTD