Protein Info for Psest_3296 in Pseudomonas stutzeri RCH2

Annotation: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00089: Trypsin" amino acids 109 to 267 (159 residues), 62.8 bits, see alignment E=1.1e-20 PF13365: Trypsin_2" amino acids 110 to 244 (135 residues), 110 bits, see alignment E=4.3e-35 PF00595: PDZ" amino acids 277 to 360 (84 residues), 38.6 bits, see alignment E=2.9e-13 PF13180: PDZ_2" amino acids 284 to 374 (91 residues), 59.4 bits, see alignment E=8.3e-20 PF17820: PDZ_6" amino acids 309 to 351 (43 residues), 43.5 bits, see alignment 5.2e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_1048)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPR5 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Psest_3296 Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain (Pseudomonas stutzeri RCH2)
MFNALRFLGWPLLVGLLVALLIIQRYPQLVGIKERDIGLRQAPLVATTPQQGPYSYANAV
AGAAPAVANLYTTKVIEKTEQQAPLSKDPLFQRFFNDNLPRQRRMESSLGSAVIMSPEGY
LLTNNHVTANAEQIVVALKDGRETLARVIGSDPETDLAVLKIDLADLPAITVGHSDRIRV
GDVTLAIGNPFGVGQTVTMGIISATGRNQLGLNTYEDFIQTDAAINRGNSGGALVDAEGN
LIGINTAIISESGGSQGIGFAIPVKLALEVMKSIIDHGQVIRGWLGVEVQSLTQELAESF
GQEGRPGIVVAGVYRDGPAARAGLQPGDLILSIDGVQSADGRSSMNQVARARPGDKIDID
ILRNGKPLTLTAEVGMRAPVSTAPK