Protein Info for Psest_3294 in Pseudomonas stutzeri RCH2

Annotation: sulfate adenylyltransferase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR02039: sulfate adenylyltransferase, small subunit" amino acids 8 to 305 (298 residues), 510.7 bits, see alignment E=7.2e-158 PF01507: PAPS_reduct" amino acids 28 to 259 (232 residues), 197.3 bits, see alignment E=1.1e-62

Best Hits

Swiss-Prot: 98% identical to CYSD_PSEU5: Sulfate adenylyltransferase subunit 2 (cysD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 98% identity to psa:PST_1050)

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQW6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_3294 sulfate adenylyltransferase, small subunit (Pseudomonas stutzeri RCH2)
MVDKLTHLKQLEAESIHIIREVAAEFGNPVMLYSIGKDSAVMLHLARKAFFPGKLPFPVL
HVDTRWKFQEMYSFRAKMVEEMGLELITHINPDGVAQDMNPFTYGSAKHTDVMKTEGLKQ
ALDKYGFDAAFGGARRDEEKSRAKERVYSFRDSKHRWDPKNQRPELWNLYNGKVKKGESI
RVFPLSNWTELDIWQYIYLEQIPIVPLYFAAEREVVELNGTLVMIDDERILQHLTPEQKA
SIHKKMVRFRTLGCYPLTGAVESTATSLPEIIQEMLLTRTSERQGRVIDHDATGSMEEKK
RQGYF