Protein Info for HP15_3171 in Marinobacter adhaerens HP15

Annotation: ABC efflux transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 110 to 136 (27 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 7 to 259 (253 residues), 430 bits, see alignment E=1.7e-133 PF01061: ABC2_membrane" amino acids 13 to 227 (215 residues), 115.5 bits, see alignment E=2.6e-37 PF12698: ABC2_membrane_3" amino acids 52 to 250 (199 residues), 63.1 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 67% identity to pba:PSEBR_a2653)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ70 at UniProt or InterPro

Protein Sequence (267 amino acids)

>HP15_3171 ABC efflux transporter, permease protein (Marinobacter adhaerens HP15)
MNAAHYWHCFVGIQTREWLRFWQQRTRFASALVRPLLWLVVFAAGFRAVLGISIIPPYET
YITYETYIAPGLCGMIILFNSMQGALSMVYDRELGSMRVLLMSPLPRPFLLVTKLLAMGV
VSIGQVYVFLLLALLVDVEPPLWGYLAVLPALILTSLMLGALGLLIATWIKQLENFAGVM
NFVIFPMFFMSSALYPLWRMNEASPWLYWICQFNPFTHAVEAIRFSLYLEWNPMAYGITA
GVTVVLALLATAGFRPQRTRILGSKPA