Protein Info for HP15_3169 in Marinobacter adhaerens HP15

Annotation: 40-residue YVTN family beta-propeller repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 36 to 341 (306 residues), 514 bits, see alignment E=1.3e-158 PF10282: Lactonase" amino acids 43 to 147 (105 residues), 27.3 bits, see alignment E=9.8e-10 amino acids 197 to 321 (125 residues), 34.6 bits, see alignment E=6e-12 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 46 to 80 (35 residues), 44.8 bits, see alignment 9.5e-16 amino acids 124 to 165 (42 residues), 37.2 bits, see alignment 2.1e-13 amino acids 301 to 341 (41 residues), 52.3 bits, see alignment 4.3e-18 PF21783: YNCE" amino acids 87 to 277 (191 residues), 40.8 bits, see alignment E=8.1e-14 PF02239: Cytochrom_D1" amino acids 89 to 193 (105 residues), 29.8 bits, see alignment E=1.1e-10 PF22494: choice_anch_I" amino acids 143 to 302 (160 residues), 28.9 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: None (inferred from 69% identity to psa:PST_2283)

Predicted SEED Role

"FIG00443700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ68 at UniProt or InterPro

Protein Sequence (344 amino acids)

>HP15_3169 40-residue YVTN family beta-propeller repeat protein (Marinobacter adhaerens HP15)
MPDQRLSHGLPTFKTRRSYTMKTLFKRTALAAMIGLSTPALASVAYVSNEKDNTLSVIDT
ETQEVIETIDVGQRPRGILLSKDYTKLYICASDDDTVQVLDLATRKIVDTLPSGEDPEQF
ALHPNNKHLYIANEDDAIVTVVDVDSKEVLAQIDVGIEPEGMAVSPDGKWAVNTSETTSM
LHWINTETFEIEKNIVVGQRPRHVEFSKDSKIAWASAEIGGTVHIIDVDNLEQIHEMSFK
VPGVNQDRVQPVGIELTSDGKYAFVALGPSNHVAVVDAQTYEVLDYLLVGARVWQLDLDK
DEKHLYTTNGVSGDISVIDVEDLKVIKSIKVGRYPWGVVIDPTS