Protein Info for Psest_3286 in Pseudomonas stutzeri RCH2

Annotation: Type II secretory pathway, prepilin signal peptidase PulO and related peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 108 to 124 (17 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 220 to 248 (29 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF06750: A24_N_bact" amino acids 20 to 126 (107 residues), 117 bits, see alignment E=3.1e-38 PF01478: Peptidase_A24" amino acids 136 to 244 (109 residues), 99.8 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 85% identical to LEP4_PSEST: Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) from Pseudomonas stutzeri

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 90% identity to psa:PST_1057)

MetaCyc: 78% identical to prepilin leader peptidase/N-methyltransferase (Pseudomonas aeruginosa)
Prepilin peptidase. [EC: 3.4.23.43]; 2.1.1.- [EC: 3.4.23.43]

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPQ6 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Psest_3286 Type II secretory pathway, prepilin signal peptidase PulO and related peptidases (Pseudomonas stutzeri RCH2)
MILLDYLASHVLAFVLSAAVLGLLVGSFLNVVIYRLPIMMQRDWRMQALEYLESPAEPVG
ERFNLLLPNSRCPHCNHQIRSWENIPLVSWLALRGKCSSCRAPISCRYPLVELACGLLSG
YVAWHFGFSWQAGAMLLLTWGLLAMSMIDVDHQLLPDVLVLPLLWLGLILNNFGLFVSLE
SALWGAVAGYLSLWSVYWLFKVVTGKEGMGYGDFKLLAMLGAWGGWQVLPLTILLSSVVG
AVLGSILLRMQRAESNTPIPFGPYLAIAGWIALLWGDWITESYLQFVRF