Protein Info for Psest_0323 in Pseudomonas stutzeri RCH2

Annotation: S-adenosylmethionine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR01034: methionine adenosyltransferase" amino acids 6 to 393 (388 residues), 596.1 bits, see alignment E=1.3e-183 PF00438: S-AdoMet_synt_N" amino acids 6 to 101 (96 residues), 139.5 bits, see alignment E=6.9e-45 PF02772: S-AdoMet_synt_M" amino acids 115 to 232 (118 residues), 154.2 bits, see alignment E=2.4e-49 PF02773: S-AdoMet_synt_C" amino acids 234 to 366 (133 residues), 221.6 bits, see alignment E=4.7e-70

Best Hits

Swiss-Prot: 98% identical to METK_PSEU5: S-adenosylmethionine synthase (metK) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 98% identity to psa:PST_3926)

MetaCyc: 73% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHZ7 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Psest_0323 S-adenosylmethionine synthetase (Pseudomonas stutzeri RCH2)
MSEYSIFTSESVSEGHPDKIADQISDAVLDAIIAEDKHARVACETLVKTGVAIVAGEVTT
SAWVDLEQLVRDVIIDIGYNSSEVGFDGATCGIINIIGKQSVDIAQGVDRSKPEDQGAGD
QGLMFGYASNETDVLMPAPIRFSHALVERQAEARKNGLLPWLRPDAKSQVTCRYENGKVA
GIDAVVLSTQHNPDVKQSDLREAVMELIIKHSLPAELLHKDTQYHINPTGQFVIGGPVGD
CGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADRCEIQV
SYAIGVAQPTSISLNTFGTGKLSDDKIIALVREHFDLRPYAITTMLDLLHPMYRATAAYG
HFGRTPYEMTVGADTFTAFTWERTDKADALRAAAGL