Protein Info for HP15_3160 in Marinobacter adhaerens HP15

Annotation: quinoprotein alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 24 to 556 (533 residues), 797.6 bits, see alignment E=2.7e-244 PF13360: PQQ_2" amino acids 82 to 232 (151 residues), 66.8 bits, see alignment E=3.5e-22 amino acids 470 to 552 (83 residues), 40.7 bits, see alignment E=3.4e-14 PF01011: PQQ" amino acids 92 to 123 (32 residues), 30.6 bits, see alignment (E = 3e-11) amino acids 502 to 538 (37 residues), 33.7 bits, see alignment 3.1e-12 PF13570: PQQ_3" amino acids 111 to 159 (49 residues), 19.1 bits, see alignment 2.2e-07 amino acids 480 to 520 (41 residues), 36.1 bits, see alignment 9.2e-13

Best Hits

Swiss-Prot: 54% identical to EXAA_PSEAE: Quinoprotein alcohol dehydrogenase (cytochrome c) (exaA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 76% identity to psa:PST_2265)

MetaCyc: 54% identical to alcohol dehydrogenase (cytochrome c550) monomer (Pseudomonas aeruginosa)
RXN-11333 [EC: 1.1.2.8]

Predicted SEED Role

"Quino(hemo)protein alcohol dehydrogenase, PQQ-dependent (EC 1.1.99.8)" (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.8 or 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ59 at UniProt or InterPro

Protein Sequence (591 amino acids)

>HP15_3160 quinoprotein alcohol dehydrogenase (Marinobacter adhaerens HP15)
MRTNKFGIRIAASALAMAVSYGAHAVTDEDIINDHKTPEDIVSYGMGTQGQRYSILEDLN
TSNVQYLQPAWAFSFGSEKMRGQESQPLIKDGVMYVTASYSRIYAIDARTGEEIWQYDAR
LPDGIMPCCDVVNRGAAIYGDKVIFGTLDAKLVALNKDTGKPMWIKKVADYQAGYAITAA
PMVIKGKVITGVSGGEFGIVGKVEAYDANTGDLVWTRPTVEGHMGYVYKDGKKIENGISG
GKAGVTWPGEMWKNGGAATWLGGTYDPDTDSLFFGTGNPAPWNSHLRPGDNLFSSSRLAI
DPDDGSIKWHFQTTPNDGWDYDGVNELISFDYEENGKTVKAAATADRNGFFYVLNRENGD
FIRGFPFVDKITWAEGLDPKTGRPIYAEGGRPGNPADMEGGKGEMVLAQPAFLGGKNWMP
MAFSQQTGLFYVPSNEWSMDIWNEPVSYKKGAAFLGAGFTIKPANDDYIGVLRAMDPKTG
EEVWRYENTAPLWGGVMTTAGGLVFTGTPEGHLKAFDAKTGEELYRFNTGSGVVGTPITW
TMDGEQYVSVASGWGGAVPLWGGEVAKVVKDFNQGGMVWTFKLPKDRVASN