Protein Info for Psest_3278 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome b subunit of the bc complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF00033: Cytochrome_B" amino acids 24 to 211 (188 residues), 220 bits, see alignment E=3.7e-69 PF13631: Cytochrom_B_N_2" amino acids 93 to 264 (172 residues), 146.3 bits, see alignment E=1.4e-46 PF00032: Cytochrom_B_C" amino acids 277 to 379 (103 residues), 140.5 bits, see alignment E=3e-45

Best Hits

Swiss-Prot: 64% identical to CYB_ALLVD: Cytochrome b (petB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 96% identity to psa:PST_1064)

MetaCyc: 48% identical to cytochrome b (Acidithiobacillus ferrooxidans)
RXN-15829 [EC: 7.1.1.8]

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2 or 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR30 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Psest_3278 Cytochrome b subunit of the bc complex (Pseudomonas stutzeri RCH2)
MSKFMEWVDARFPATKMWEDHLSKYYAPKNFNVLYFFGSLALLVLVNQILTGIWLTMSYE
PSAEGAFASVEYIMRDVEYGWILRYLHSTGASAFFVVVYLHMFRGILYGSYQKPRELVWI
FGMMIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGGDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPLGVDIKKSKDENGVPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEEANALKTPAHIAPVWYFTPFYAIL
RAVPDKLLGVIAMGAAIAVLFVLPWLDRSPVKSMKYKGWMSKVALLLFCISFVILGVLGV
LSPTPGRTLLSQICTAIYFGYFILMPFYTKLEKTKVVPQRVDG