Protein Info for Psest_3274 in Pseudomonas stutzeri RCH2

Annotation: Predicted periplasmic or secreted lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04972: BON" amino acids 45 to 114 (70 residues), 48.6 bits, see alignment E=4.3e-17 amino acids 124 to 189 (66 residues), 59.7 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_1068)

Predicted SEED Role

"21 kDa hemolysin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQU4 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Psest_3274 Predicted periplasmic or secreted lipoprotein (Pseudomonas stutzeri RCH2)
MNAFRLAFTLGLCIAVSGCSSVLTATRDDPIADNRGTRTIGSKIDDSLIETKAAVNIAKA
HPDLDQGSHVVVASYNGVVLLAGQTPRAELKETAERAASGVQRVKRVHNELQILPPSSAL
ARSNDSWLTTKIKTQMLADNSVPGSRIKVITENGIVYLLGLVTRQEGNRATNLVQGVAGV
QRIVKLFEYID