Protein Info for Psest_3273 in Pseudomonas stutzeri RCH2

Annotation: Phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF13580: SIS_2" amino acids 14 to 146 (133 residues), 119.5 bits, see alignment E=1.2e-38 PF01380: SIS" amino acids 88 to 154 (67 residues), 26.2 bits, see alignment E=6.1e-10

Best Hits

Swiss-Prot: 93% identical to GMHA_PSEPF: Phosphoheptose isomerase (gmhA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 91% identity to ppu:PP_1323)

MetaCyc: 44% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR24 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Psest_3273 Phosphoheptose isomerase (Pseudomonas stutzeri RCH2)
MDMQTRIRQLFQASIETKQHAMEVLAPSIEQAGQVMVNALLSEGKILTCGNGGSAGDAQH
FSSELLNRFERERPSLPAIALTTDSSTITSIANDYSYNEVFSKQIRALGQPGDVLLAIST
SGNSANVIQAIQAAHDREMVVVALTGRDGGGMASLLLPEDVEIRVPAKVTARIQEVHLLT
IHCLCDLIDNQLFGSEE