Protein Info for PGA1_c32610 in Phaeobacter inhibens DSM 17395

Annotation: high-affinity branched-chain amino acid transport permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 313 (302 residues), 80.9 bits, see alignment E=4.5e-27

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 94% identity to sit:TM1040_0115)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E512 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PGA1_c32610 high-affinity branched-chain amino acid transport permease protein (Phaeobacter inhibens DSM 17395)
MPEQLVFAMEVTLNGLMAGVLYALVALGFVLIYKASGIFNYAQGVMALFAAMTLVGIMNG
QVPFSHVINAIFGGHITHFGWTVPSFVAIVMTVGVMVLLAWMVQHFVMRHLVGQEPIILF
MATIGLAYFLEGVADLMWGSEIKALDVGLPQGINLWIDETTYQIFDYGFFIDNLDIVATV
IAALLVMGLVAFAQYTKQGRAMRAVADDHQAALSVGISLNFIWVLVWSVAGFVALVAGIM
WGTKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIGVGEKLFEFMIGPMVGGATE
NWFAYVLALLFLVFRPQGLFGEKIIERV