Protein Info for HP15_3147 in Marinobacter adhaerens HP15

Annotation: urea carboxylase-associated protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR03424: urea carboxylase-associated protein 1" amino acids 12 to 211 (200 residues), 335.7 bits, see alignment E=4.2e-105 PF09347: DUF1989" amino acids 16 to 185 (170 residues), 227.3 bits, see alignment E=4.5e-72

Best Hits

KEGG orthology group: K09967, hypothetical protein (inferred from 79% identity to hna:Hneap_0797)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPP1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>HP15_3147 urea carboxylase-associated protein 1 (Marinobacter adhaerens HP15)
MIKQSVLKPENAAFRETVPAGEYFLKVVKAGETVRILDLEGNQAADTLFYNAHNPTERYS
AIDTIREQGNVYLTAGSKLMSSENNVMLEITADTCGRHDTLGGACAAESNTTRYALEKKC
MHACRDSWLVAVTEHEELGMSKRDITHNINFFMNVPVTADGGLTFADGISDAGKYVELEA
KMDVLVMISNCPQLNNPCNGWNPTPIEVLVWS