Protein Info for PGA1_c32580 in Phaeobacter inhibens DSM 17395

Annotation: high-affinity branched-chain amino acid transport permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 271 to 301 (31 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 333 (282 residues), 106.4 bits, see alignment E=7.4e-35

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 91% identity to sit:TM1040_0118)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUZ8 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PGA1_c32580 high-affinity branched-chain amino acid transport permease protein (Phaeobacter inhibens DSM 17395)
MFYREAGDFKTSYQDDSQTFPIKFDRIRYYVVLALAFLVVPFVVNDYWANAILLPFLIYS
IAAIGLNILVGYCGQVSLGTGGFMAVGAYACYKLMTAFPEMSMFIHVLLAGGITALVCIG
FGLPSLRIKGFYLAVATLAAQFFLVWLFNRVPWFYNYSASGQISAPERDVFGIIITGPNA
PAWATYMFSLIFLAFCALVARNLTRGTVGRSWMAIRDMDIAAEIIGVNPLKAKLSAFGVS
GFFIGVSGALFFSVYLGAVEVGEAFGINKSFLVLFMVIIGGLGSIFGSFAGAAFLVLLPV
VLKVVGVDVLGWPTDIVAHIQLVIVGALIVIFLIAEPHGIAQLWRVAKEKLRLWPFPH