Protein Info for Psest_3264 in Pseudomonas stutzeri RCH2

Annotation: UDP-N-acetylmuramyl-tripeptide synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF01225: Mur_ligase" amino acids 18 to 94 (77 residues), 44.1 bits, see alignment E=3.2e-15 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 18 to 479 (462 residues), 516.7 bits, see alignment E=3.3e-159 PF08245: Mur_ligase_M" amino acids 106 to 306 (201 residues), 187.9 bits, see alignment E=3.2e-59 PF02875: Mur_ligase_C" amino acids 329 to 455 (127 residues), 113.1 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 76% identical to MURE_PSEMY: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 92% identity to psa:PST_1077)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP05 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Psest_3264 UDP-N-acetylmuramyl-tripeptide synthetase (Pseudomonas stutzeri RCH2)
MPMPLNHLLPQAGSDVLIRELTLDSRKVRGGDLFLAVPGLQFDGRDHAQDAIARGAAAVA
YEAEGLVQPLVGEAVMVPVQHLASQLSAIAGRFYGEPSRNMRLVGVTGTNGKTSVSQLIA
QALDRLGEPCGIIGTLGTGFHGQLELGRHTTPDAIGVQATLANLKQEGARAVAMEVSSHG
LDQGRVAALDFDVAVFTNLSRDHLDYHGTMEAYGAAKARLFNVPGLRCRVINLDDGFGRA
LAGEDRESRLITYSLEDPSAYLYCAEARLDDDGIHARLITPQGERSMRSPLLGRFNVSNV
LAAVGALLGMDYALDEILAVLPELEGPAGRMQRLGGGDHPLIVVDYAHTPDALEKVLTAL
RPHARGRLLCLFGCGGDRDTGKRPLMAEVAERLADGIVVTDDNPRNEAPERIVEDIRSGF
VNPAAATFAHGRAQAIAGLIATAHAEDVVVLAGKGHEDYQEIRGERLPFSDIEEACKALS
IWEKPNA