Protein Info for Psest_3261 in Pseudomonas stutzeri RCH2

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 10 to 96 (87 residues), 89.5 bits, E=2.1e-29
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 11 to 444 (434 residues), 399.9 bits, E=8.4e-124
• PF08245: Mur_ligase_M
  • amino acids 113 to 284 (172 residues), 86.7 bits, E=3.3e-28
• PF02875: Mur_ligase_C
  • amino acids 307 to 423 (117 residues), 63.5 bits, E=5.4e-21

Best Hits

Swiss-Prot: 80% identical to MURD_PSE14: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 93% identity to psa:PST_1080)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See L0GLW9 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Psest_3261 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Pseudomonas stutzeri RCH2)
MLIASDQFRIVVGLGKSGMSLVRHLARRGLPFAVADTRANPPELATLKAEYPDVQVRCGE
LDVEFLCAASELLVSPGLAVSTPALQEAAARGVKLSGDIELFAREAKAPIIAITGSNAKS
TVTTLVGEMAAAAGRKVAVGGNLGTPALDLLADDVELYVLELSSFQLETTGQLNAEVATC
LNISEDHMDRYSGLPAYHQAKHRIFRGARQVVVNRDDRLSRPLIGDEVPTWTFGLGKPDF
KGFGLFEEKGEKYLAFQFEALMPVRELKMRGAHNQSNALAALALGHAVGLPFAPMLETLR
RFTGLPHRCQWVGQRGDVSYYDDSKATNVGAALAAIEGLGADIDGKLVLIAGGDGKGADF
SGLRAPVARYCRAVVLLGRDAQRLADTLDDATTLLHVASLEEAVRRAADCAEAGDAVLLS
PACASLDMFKNFEERGRLFAAAVEALS