Protein Info for Psest_3259 in Pseudomonas stutzeri RCH2

Annotation: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 4 to 349 (346 residues), 363.2 bits, see alignment E=6.8e-113 PF03033: Glyco_transf_28" amino acids 5 to 141 (137 residues), 139.2 bits, see alignment E=1.5e-44 PF13579: Glyco_trans_4_4" amino acids 20 to 142 (123 residues), 30.3 bits, see alignment E=7.7e-11 PF04101: Glyco_tran_28_C" amino acids 182 to 340 (159 residues), 136.4 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 95% identical to MURG_PSEU5: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 95% identity to psa:PST_1082)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNZ8 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Psest_3259 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase (Pseudomonas stutzeri RCH2)
MAANVLIMAGGTGGHVFPALACAREFQARGYSVHWLGTPRGIENELVPAAGLPLHLIQIS
GLRGKNLASLIKAPLQLVRSLFQARRIIRELRPVCVLGLGGYVTGPGGLAAKLAGVPLVI
HEQNAVAGTANRSLVPLASRVCEAFPDTFKASAKRRTTGNPVREELFLETPRDTLIGRRP
RLLVLGGSLGAEPLNKLLPAALAQLPVELRPEVFHQAGKQHAELTTQRYAEAAVEAEVAP
FIKDMARAYAWADLVICRAGALTVCELAAAGLPSFLVPLPHAIDDHQTRNAEYLAKEGAA
VLLPQAKTDAAALAAQLTEVMMQPEKLKAMGATARRLARPDATRSVVEICLEVAHG