Protein Info for Psest_3256 in Pseudomonas stutzeri RCH2

Annotation: Cell division septal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 48 to 65 (18 residues), see Phobius details PF08478: POTRA_1" amino acids 75 to 143 (69 residues), 64.8 bits, see alignment E=7.5e-22 PF03799: FtsQ_DivIB_C" amino acids 147 to 260 (114 residues), 87.4 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 68% identical to FTSQ_PSEAE: Cell division protein FtsQ (ftsQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 96% identity to psa:PST_1085)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLW4 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psest_3256 Cell division septal protein (Pseudomonas stutzeri RCH2)
MIATLRHSQPASGRASRKPAQRGASRLVQPQPLSQRLPKLNFAGLKRFVWPVLLVGLAVG
LYELGERLLPYADRPIAKVSVQGELGYVSREAVQQRIAPFVEQSFFKVDLNGMRHQLEQM
PWIAHVEVRRVWPDQVMVRLDEQLPIARWGGEALLNNKGQAFSPDDLSRYEHLPHLYGPK
RAQQRVMQQYQMLSQMLRPLGFSISRLELRERGSWFLTTNQGIELLLGRDQVVEKMRRFT
AIYQKALEQESEKIARIDLRYANGLAVAWHEPVPTATDTTVAARN