Protein Info for HP15_3136 in Marinobacter adhaerens HP15

Annotation: prolyl oligopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 PF20434: BD-FAE" amino acids 350 to 542 (193 residues), 36.6 bits, see alignment E=8.7e-13 PF00326: Peptidase_S9" amino acids 378 to 585 (208 residues), 149.5 bits, see alignment E=2.6e-47 PF01738: DLH" amino acids 421 to 576 (156 residues), 35.9 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: None (inferred from 44% identity to ppg:PputGB1_0404)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F (EC 3.4.99.-)" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.99.-

Use Curated BLAST to search for 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPM9 at UniProt or InterPro

Protein Sequence (594 amino acids)

>HP15_3136 prolyl oligopeptidase family protein (Marinobacter adhaerens HP15)
MSPAGVFWLETDPARGCNTLWHLSNQGPVRLGPDDLGIRSRVNGYGGGALAAADSGVFVV
GEDQQIRFVSLADGQCHSLTDDPGAAYGGLVADQYRQRVLAVREAEGKQQLVAVSMQGER
SVLHSGLDFYSAPAVSADGSQVAWTSWQLPDMPWLRSRLWTANCSEDGLLDQGREWPTPS
EASVQQPVFDGNQLWVLSDHEGWWQPWRIDTSGEGSWHASDSPARDHANAPWQLGESHHC
PTGRGGWARVRYCNGTGELWLSSGQTGDAIRAARDFGDFRCLQSAGEHLYCIGRASSRLD
AVLEIDLETGQARTIAGGEEAMPEARAALPLDIEIPALNPGEASIHGFFYTPKLATPDVP
PLILIAHGGPTSAAYPVFNPQVQYWCQRGFAVAEINYRGSTGFGREFRLALEGRWGEVDV
ADMERAADHLASFGLADGSRVFIQGRSSGGYTALMAMIRSQRFTAGASMFGVTDPMRLRA
MTHRFESGYLDWLLGSPEKHPKRWRDRTPLFHADRITAPMIFFQGGQDKVVVPEQTRAMA
EAMKAAGRAPELHWFEDEGHGFRRQANQAGMLEWMFSFYRKHSQKANDHAENLS