Protein Info for Psest_3255 in Pseudomonas stutzeri RCH2

Annotation: cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01174: cell division protein FtsA" amino acids 12 to 381 (370 residues), 528 bits, see alignment E=6.6e-163 PF14450: FtsA" amino acids 14 to 183 (170 residues), 34.6 bits, see alignment E=4.8e-12 amino acids 210 to 377 (168 residues), 139.1 bits, see alignment E=2.1e-44 PF02491: SHS2_FTSA" amino acids 88 to 165 (78 residues), 112.3 bits, see alignment E=2.2e-36 PF06723: MreB_Mbl" amino acids 173 to 354 (182 residues), 54 bits, see alignment E=2.4e-18

Best Hits

Swiss-Prot: 90% identical to FTSA_PSEAE: Cell division protein FtsA (ftsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03590, cell division protein FtsA (inferred from 98% identity to psa:PST_1086)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPM9 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Psest_3255 cell division protein FtsA (Pseudomonas stutzeri RCH2)
MKHMSSVQSGKMIVGLDIGTSKVVALVGEVTADGELEIVGIGTHPSRGLKKGVVVNIEST
VQSIQRAIEEAQLMAGCRIHSAFVGLAGNHIRSLNSHGIVAIRDREVSSADLERVLDAAQ
AVAIPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNVEKCVRR
CGLEVDDIILEQLASAHAVLTDDEKELGVCLVDIGGGTTDICIFTEGAIRHTAVIPIAGD
QVTNDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVV
EPRYDELFTLIQAELRRSGYEDLVPAGIVLTGGTAKMEGAVDLAEEIFHMPVRLGVPHSV
KGLSDVVRNPIYSTGVGLLLYGLHKQADGIPVPGIGSFAEESKTSVLDRLKGWIQGNF