Protein Info for Psest_3253 in Pseudomonas stutzeri RCH2

Annotation: UDP-3-0-acyl N-acetylglucosamine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase" amino acids 2 to 298 (297 residues), 399.9 bits, see alignment E=3.7e-124 PF03331: LpxC" amino acids 4 to 275 (272 residues), 375.8 bits, see alignment E=6.8e-117

Best Hits

Swiss-Prot: 91% identical to LPXC_PSEAE: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 100% identity to psa:PST_1088)

MetaCyc: 58% identical to UDP-3-O-acyl-N-acetylglucosamine deacetylase (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN-23222 [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQS1 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psest_3253 UDP-3-0-acyl N-acetylglucosamine deacetylase (Pseudomonas stutzeri RCH2)
MIRQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFCRTDLNPPVEIPARAENVGET
TMSTTLVNGDVKVDTVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQ
EQDAHKKFIRIKREVTVEEGDKRATFLPFDGFKVSFEIDFDHPVFKGRTQTASVDFSSTS
FVKEVSRARTFGFMRDIEFLRSHNLALGGSVENAIVVDETSVLNEDGLRYEDEFVKHKIL
DAIGDLYLLGTSLIGEFRGYKSGHALNNRLLRTLMEQKDAWELVTFDDPQTAPISYMRPV
AAG