Protein Info for HP15_3128 in Marinobacter adhaerens HP15

Annotation: methionine sulfoxide reductase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF01625: PMSR" amino acids 32 to 198 (167 residues), 233.3 bits, see alignment E=9.2e-74 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 32 to 182 (151 residues), 189.4 bits, see alignment E=2.5e-60

Best Hits

Swiss-Prot: 50% identical to MSRA2_SYNY3: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 80% identity to maq:Maqu_3402)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPM1 at UniProt or InterPro

Protein Sequence (217 amino acids)

>HP15_3128 methionine sulfoxide reductase A (Marinobacter adhaerens HP15)
MTTSCSIPGLNVPRSRFPDPEQDLPAAEGEQRVVLAGGCFWCVEAVFLAIDGVTSVESGY
AGGHASSANYEAVCSGTTGHAEVVDVHYDPARVSFGELLKVFFSVAHDPTQLNRQGNDRG
TQYRSAVFYETAEQRRVAEAYIHQLNQAEVYPDPIVTTLEPLEAFYPAEEYHQNFAARNP
YQPYIMAVAAPKMEKLVDSYPDRLKPEFTDNDAGSTA