Protein Info for Psest_3243 in Pseudomonas stutzeri RCH2

Annotation: TIGR00730 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR00730: TIGR00730 family protein" amino acids 5 to 176 (172 residues), 210.2 bits, see alignment E=9.8e-67 PF18306: LDcluster4" amino acids 11 to 120 (110 residues), 59.5 bits, see alignment E=3.1e-20 PF03641: Lysine_decarbox" amino acids 48 to 177 (130 residues), 156.1 bits, see alignment E=5.6e-50

Best Hits

Swiss-Prot: 73% identical to LOGH_PSEAE: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase (PA4923) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06966, (no description) (inferred from 94% identity to psa:PST_1098)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQR1 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Psest_3243 TIGR00730 family protein (Pseudomonas stutzeri RCH2)
MTLRSICVFCGASRGTNPIYEQAAQDLGRTLAANGIRLIYGGGAVGLMGVVADATMAAGG
EVIGIIPQSLKDAEVGHTGLTRLEVVDGMHARKARMAELADAFIALPGGLGTLEELFEVW
TWGQLGYHPKPLGLLDINHFYSKLSHFLDHLVDEGFVRPQHRQMLQRSDQPQALIKLLDA
WQPPAHSRWDKTAPQ