Protein Info for PGA1_c32210 in Phaeobacter inhibens DSM 17395

Annotation: 3,4-dihydroxyphenylacetate 2,3-dioxygenase HpaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR02295: 3,4-dihydroxyphenylacetate 2,3-dioxygenase" amino acids 13 to 307 (295 residues), 413.5 bits, see alignment E=2.3e-128 PF22677: Ble-like_N" amino acids 16 to 44 (29 residues), 27.6 bits, see alignment (E = 2.9e-10) amino acids 149 to 176 (28 residues), 27.7 bits, see alignment (E = 2.8e-10) PF00903: Glyoxalase" amino acids 16 to 112 (97 residues), 37.3 bits, see alignment E=4.9e-13 amino acids 149 to 266 (118 residues), 66.5 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: K00446, catechol 2,3-dioxygenase [EC: 1.13.11.2] (inferred from 87% identity to jan:Jann_3502)

Predicted SEED Role

"homoprotocatechuate 2,3-dioxygenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERC4 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PGA1_c32210 3,4-dihydroxyphenylacetate 2,3-dioxygenase HpaD (Phaeobacter inhibens DSM 17395)
MPVPAPNLYPDFNTIRLSHVCLNVKDLAASQKFYAEILGLRVSDADENRIYLRAMEERGH
HCVILQQSDQPGTVEVMGFKTFDEEDLDRADAYFRKKGRPTEWVQRPYQGRTLLTSDNMG
IPLEFYHKMDRLEPIHQQYALYRGVKPLRIDHFNCFSHDVDASVAFYSDFGFRVTEYTED
EDSKKLWAAWLHRKGGVHDMAFTNGTGPRMHHVAFWVPNPLNIIDLLDLMATTGYVTNIE
RGPGRHGISNAFFLYILDPDGHRIEIYCSDYQTVDPDLEPIKWDLKDPQRQTLWGAPAPE
SWFKHGSRFVGVTPKESELQASPIIAP