Protein Info for PGA1_c32210 in Phaeobacter inhibens DSM 17395
Annotation: 3,4-dihydroxyphenylacetate 2,3-dioxygenase HpaD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00446, catechol 2,3-dioxygenase [EC: 1.13.11.2] (inferred from 87% identity to jan:Jann_3502)Predicted SEED Role
"homoprotocatechuate 2,3-dioxygenase"
MetaCyc Pathways
- catechol degradation to 2-hydroxypentadienoate I (1/2 steps found)
- 2-nitrotoluene degradation (1/3 steps found)
- catechol degradation I (meta-cleavage pathway) (2/5 steps found)
- catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
- toluene degradation to 2-hydroxypentadienoate (via toluene-cis-diol) (1/4 steps found)
- toluene degradation to 2-hydroxypentadienoate I (via o-cresol) (1/4 steps found)
- catechol degradation II (meta-cleavage pathway) (2/7 steps found)
- toluene degradation I (aerobic) (via o-cresol) (2/7 steps found)
- toluene degradation V (aerobic) (via toluene-cis-diol) (2/7 steps found)
- toluene degradation II (aerobic) (via 4-methylcatechol) (1/6 steps found)
- meta cleavage pathway of aromatic compounds (3/10 steps found)
- naphthalene degradation to acetyl-CoA (3/12 steps found)
- mandelate degradation to acetyl-CoA (7/18 steps found)
- toluene degradation IV (aerobic) (via catechol) (3/13 steps found)
- superpathway of aerobic toluene degradation (11/30 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (10/42 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Benzoate degradation via hydroxylation
- Carbazole degradation
- Styrene degradation
- Toluene and xylene degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.13.11.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7ERC4 at UniProt or InterPro
Protein Sequence (327 amino acids)
>PGA1_c32210 3,4-dihydroxyphenylacetate 2,3-dioxygenase HpaD (Phaeobacter inhibens DSM 17395) MPVPAPNLYPDFNTIRLSHVCLNVKDLAASQKFYAEILGLRVSDADENRIYLRAMEERGH HCVILQQSDQPGTVEVMGFKTFDEEDLDRADAYFRKKGRPTEWVQRPYQGRTLLTSDNMG IPLEFYHKMDRLEPIHQQYALYRGVKPLRIDHFNCFSHDVDASVAFYSDFGFRVTEYTED EDSKKLWAAWLHRKGGVHDMAFTNGTGPRMHHVAFWVPNPLNIIDLLDLMATTGYVTNIE RGPGRHGISNAFFLYILDPDGHRIEIYCSDYQTVDPDLEPIKWDLKDPQRQTLWGAPAPE SWFKHGSRFVGVTPKESELQASPIIAP