Protein Info for Psest_3226 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details PF01169: GDT1" amino acids 8 to 80 (73 residues), 72.5 bits, see alignment E=1.5e-24 amino acids 105 to 179 (75 residues), 71.4 bits, see alignment E=3.3e-24

Best Hits

Swiss-Prot: 58% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 97% identity to psa:PST_1115)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQY0 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Psest_3226 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MESFFVPTLIVALAEIGDKTQLLALLLAARYRRPWPIIWGIVVATLANHAAAGAVGSWVS
SLLSPVALSWILAASFAAVALWTLVPDKLDDDDARLGRPYGPFVATTIAFFIAEMGDKTQ
VATVMLAAQYPEFVLVILGTTVGMLLANVPVVLVSHFAADRLPLTLIRRVAAAGFAALAL
YAGYQALTMSTIVSG