Protein Info for Psest_3224 in Pseudomonas stutzeri RCH2

Annotation: 16S RNA G1207 methylase RsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF08468: MTS_N" amino acids 5 to 151 (147 residues), 139.9 bits, see alignment E=2.3e-44 PF05175: MTS" amino acids 162 to 328 (167 residues), 195 bits, see alignment E=2.2e-61 PF06325: PrmA" amino acids 184 to 262 (79 residues), 25.9 bits, see alignment E=2e-09 PF13649: Methyltransf_25" amino acids 195 to 292 (98 residues), 39 bits, see alignment E=3.2e-13

Best Hits

Swiss-Prot: 85% identical to RSMC_PSEU5: Ribosomal RNA small subunit methyltransferase C (rsmC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 85% identity to psa:PST_1116)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLT9 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psest_3224 16S RNA G1207 methylase RsmC (Pseudomonas stutzeri RCH2)
MDPRSEVLLRQAELFQGRLLLAGLPADDLLGQLPGAVGWSWHAGEQHLLNKRFSGRCSFG
VTPPPGEYDAAVLFLPKSRELTDYVLQALAAQLAGRPLYLVGEKRAGVERAAKQLANLGR
ARKLDSARHCQLWQGEIEQAPAVPELDALAHHFTLELEDGPLQVISLPGVFSHGRLDVGS
ALLLEHLDNLPSGRVLDFGCGAGILGATLKRRYPQSELVLLDVDAFAVESSRRTLAANGL
EAEVIAGDGIDTAPRQLAAIVSNPPFHQGVHTSYQASETLIERAAEHLSSGGELRLVANA
FLRYPPLIEQHLGACQTIVERNGFRIYRAKRS